Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of NKX2-5 monoclonal antibody (M01), clone 1E4-G5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about NKX2-5 monoclonal antibody (M01), clone 1E4-G5
| Brand: | Abnova |
| Reference: | H00001482-M01 |
| Product name: | NKX2-5 monoclonal antibody (M01), clone 1E4-G5 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant NKX2-5. |
| Clone: | 1E4-G5 |
| Isotype: | IgG1 Kappa |
| Gene id: | 1482 |
| Gene name: | NKX2-5 |
| Gene alias: | CHNG5|CSX|CSX1|NKX2.5|NKX2E|NKX4-1 |
| Gene description: | NK2 transcription factor related, locus 5 (Drosophila) |
| Genbank accession: | BC025711 |
| Immunogen: | NKX2-5 (AAH25711, 1 a.a. ~ 324 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MFPSPALTPTPFSVKDILNLEQQQRSLAAAGELSARLEATLAPSSCMLAAFKPEAYAGPEAAAPGLPELRAELGRAPSPAKCASAFPAAPAFYPRAYSDPDPAKDPRAEKKELCALQKAVELEKTEADNAERPRARRRRKPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKCKRQRQDQTLELVGLPPPPPPPARRIAVPVLVRDGKPCLGDSAPYAPAYGVGLNPYGYNAYPAYPGYGGAACSPGYSCTAAYPAGPSPAQPATAAANNNFVNFGVGDLNAVQSPGIPQSNSGVSTLHGIRAW |
| Protein accession: | AAH25711 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (61.38 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | NKX2-5 monoclonal antibody (M01), clone 1E4-G5. Western Blot analysis of NKX2-5 expression in human thyroid(diffuse hyperplasia). |
| Applications: | WB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | RNA toxicity in myotonic muscular dystrophy induces NKX2-5 expression.Yadava RS, Frenzel-McCardell CD, Yu Q, Srinivasan V, Tucker AL, Puymirat J, Thornton CA, Prall OW, Harvey RP, Mahadevan MS. Nat Genet. 2008 Jan;40(1):61-8. Epub 2007 Dec 16. |