Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of IGHG1-Fc (Human) Recombinant Fusion Protein
| Brand | Abnova |
| Product type | Proteins |
| Reactivity | Human |
| Host species | Insect |
| Applications | Func,SDS-PAGE |
More info about IGHG1-Fc (Human) Recombinant Fusion Protein
| Brand: | Abnova |
| Reference: | P6023 |
| Product name: | IGHG1-Fc (Human) Recombinant Fusion Protein |
| Product description: | Human IGHG1 (P01857) partial recombinant protein expressed in Hi-5 Insect cells. |
| Gene id: | 3500 |
| Gene name: | IGHG1 |
| Gene alias: | - |
| Gene description: | immunoglobulin heavy constant gamma 1 (G1m marker) |
| Immunogen sequence/protein sequence: | LPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKRSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Protein accession: | P01857 |
| Form: | Lyophilized |
| Preparation method: | Insect cell (Hi-5) expression system |
| Recommend dilutions: | Activity assay SDS-PAGE The optimal working dilution should be determined by the end user. |
| Storage buffer: | Lyophilized from solutions contain no sodiun azide nor carrier protein |
| Storage instruction: | Store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Insect |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | Func,SDS-PAGE |
| Shipping condition: | Dry Ice |