| Reference: | P4990 |
| Product name: | Streptavidin (Streptomyces avidinii) Recombinant Protein |
| Product description: | Streptomyces avidinii Streptavidin (CAA27265, P22629, 25 a.a. - 183 a.a.) partial recombinant protein with His tag expressed in Escherichia coli (E. coli). |
| Immunogen sequence/protein sequence: | MVHHHHHHDPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ |
| Protein accession: | CAA27265, P22629 |
| Form: | Liquid |
| Concentration: | 1 mg/mL |
| Preparation method: | Escherichia coli (E. coli) expression system |
| Storage buffer: | In 20 mM Tris, pH 7.5 |
| Storage instruction: | Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Loading 3 ug protein in 15% SDS-PAGE |
| Tag: | His |
| Shipping condition: | Dry Ice |