Cart 116 Product Products 32 048,25 € (empty)
No products
265,00 € DAP Shipping
32 313,25 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 116 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 32 048,25 €
Total shipping (tax excl.) 265,00 €
Total (tax excl.) 32 313,25 €
Data sheet of ACACA monoclonal antibody (M01), clone 6H5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about ACACA monoclonal antibody (M01), clone 6H5
| Brand: | Abnova |
| Reference: | H00000031-M01 |
| Product name: | ACACA monoclonal antibody (M01), clone 6H5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ACACA. |
| Clone: | 6H5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 31 |
| Gene name: | ACACA |
| Gene alias: | ACAC|ACC|ACC1|ACCA |
| Gene description: | acetyl-Coenzyme A carboxylase alpha |
| Genbank accession: | NM_198834 |
| Immunogen: | ACACA (NP_942131, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MWWSTLMSILRARSFWKWISTQTVRIIRAVRAHFGGIMDEPSPLAQPLELNQHSRFIIGSVSEDNSEDEISNLVKLDLLEEKEGSLSPASVGSDTLSDL |
| Protein accession: | NP_942131 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged ACACA is approximately 0.03ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |