Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of Trl (Fruit fly) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Host species | Escherichia coli |
| Applications | SDS-PAGE |
More info about Trl (Fruit fly) Recombinant Protein
| Brand: | Abnova |
| Reference: | P4986 |
| Product name: | Trl (Fruit fly) Recombinant Protein |
| Product description: | Fruit fly Trl (NP_996080, 1 a.a. - 130 a.a.) partial recombinant protein expressed in Escherichia coli. |
| Gene id: | 2768981 |
| Gene name: | Trl |
| Gene alias: | Adf-2|Adf-2-519|Adf2|CG33261|CG9343|E(var)3-trl|E(var)62|GAF|GAGA|NC70F|TfGAGA/Adf-2|Trl-GAGA|anon-EST:fe2E12|l(3)s2325|unnamed |
| Gene description: | Trithorax-like |
| Immunogen sequence/protein sequence: | MSLPMNSLYSLTWGDYGTSLVSAIQLLRCHGDLVDCTLAAGGRSFPAHKIVLCAASPFLLDLLKNTPCKHPVVMLAGVNANDLEALLEFVYRGEVSVDHAQLPSLLQAAQCLNIQGLAPQTVTKDDYTTH |
| Protein accession: | NP_996080 |
| Form: | Liquid |
| Concentration: | 1 mg/mL |
| Preparation method: | Escherichia coli expression system |
| Storage buffer: | In 10 mM HEPES, 25 mM NaCl, pH 7.4 |
| Storage instruction: | Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Loading 3 ug protein in 14% SDS-PAGE |
| Quality control testing picture: |  |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Fruit fly |
| Applications: | SDS-PAGE |
| Shipping condition: | Dry Ice |