NXT2 (Human) Recombinant Protein View larger

NXT2 (Human) Recombinant Protein

New product

359,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NXT2 (Human) Recombinant Protein

BrandAbnova
Product typeProteins
Host speciesEscherichia coli
ApplicationsSDS-PAGE

More info about NXT2 (Human) Recombinant Protein

Brand: Abnova
Reference: P5014
Product name: NXT2 (Human) Recombinant Protein
Product description: Human NXT2 (NP_061168, 1 a.a. - 197 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
Gene id: 55916
Gene name: NXT2
Gene alias: P15-2
Gene description: nuclear transport factor 2-like export factor 2
Immunogen sequence/protein sequence: MGSSHHHHHHSSGLVPRGSHMGSHMRKYRSHWSQGDREGYQRRSNYYEGPHTSHSSPADRTREEVVTPTLPEHTATRSQMATSLDFKTYV DQACRAAEEFVNIYYETMDKRRRALTRLYLDKATLIWNGNAVSGLDALNNFFDTLPSSEFQVNMLDCQPVHEQATQSQTTVLVVTSGTVK FDGNKQHFFNQNFLLTAQSTPNNTVWKIASDCFRFQDWSSS
Protein accession: NP_061168
Form: Liquid
Concentration: 1 mg/mL
Preparation method: Escherichia coli expression system
Storage buffer: In 20mM Tris-HCl, 200 mM NaCl, pH 8.0 (2 mM DTT, 40% glycerol)
Storage instruction: Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
Aliquot to avoid repeated freezing and thawing.
Quality control testing: Loading 3 ug protein in 15% SDS-PAGE
Quality control testing picture: qc_test-P5014-1.jpg
Tag: His
Product type: Proteins
Host species: Escherichia coli
Antigen species / target species: Human
Applications: SDS-PAGE
Shipping condition: Dry Ice

Reviews

Buy NXT2 (Human) Recombinant Protein now

Add to cart