Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of NXT2 (Human) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Host species | Escherichia coli |
| Applications | SDS-PAGE |
More info about NXT2 (Human) Recombinant Protein
| Brand: | Abnova |
| Reference: | P5014 |
| Product name: | NXT2 (Human) Recombinant Protein |
| Product description: | Human NXT2 (NP_061168, 1 a.a. - 197 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli. |
| Gene id: | 55916 |
| Gene name: | NXT2 |
| Gene alias: | P15-2 |
| Gene description: | nuclear transport factor 2-like export factor 2 |
| Immunogen sequence/protein sequence: | MGSSHHHHHHSSGLVPRGSHMGSHMRKYRSHWSQGDREGYQRRSNYYEGPHTSHSSPADRTREEVVTPTLPEHTATRSQMATSLDFKTYV DQACRAAEEFVNIYYETMDKRRRALTRLYLDKATLIWNGNAVSGLDALNNFFDTLPSSEFQVNMLDCQPVHEQATQSQTTVLVVTSGTVK FDGNKQHFFNQNFLLTAQSTPNNTVWKIASDCFRFQDWSSS |
| Protein accession: | NP_061168 |
| Form: | Liquid |
| Concentration: | 1 mg/mL |
| Preparation method: | Escherichia coli expression system |
| Storage buffer: | In 20mM Tris-HCl, 200 mM NaCl, pH 8.0 (2 mM DTT, 40% glycerol) |
| Storage instruction: | Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Loading 3 ug protein in 15% SDS-PAGE |
| Quality control testing picture: |  |
| Tag: | His |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Human |
| Applications: | SDS-PAGE |
| Shipping condition: | Dry Ice |