Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of Protein A (Staphylococcus aureus) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Origin species | Staphylococcus |
| Host species | Escherichia coli (E. coli) |
| Applications | SDS-PAGE |
More info about Protein A (Staphylococcus aureus) Recombinant Protein
| Reference: | P4993 |
| Product name: | Protein A (Staphylococcus aureus) Recombinant Protein |
| Product description: | Staphylococcus aureus Protein A (ACD80064, 37 a.a. - 469 a.a.) partial recombinant protein expressed in Escherichia coli (E. coli). |
| Immunogen sequence/protein sequence: | MAQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPKADAQQNNFNKDQQSAFYEILNMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPKADNNFNKEQQNAFYEILNMPNLNEEQRNGFIQSLKDDPSQSANLLSEAKKLNESQAPKADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKADNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPKEEDNNKPGKEDNNKPGKEDNNKPGKEDGNKPGKEDNKKPGKEDNKKPGKEDNKKPGKEDGNKPGKEDNKKPGKEDGNGVHVVKPGDTVNDIAKANGTTADKIAADNKLADKNMIKPGQELVVDKKQPANHADANKAQALPET |
| Protein accession: | ACD80064 |
| Form: | Liquid |
| Concentration: | 1 mg/mL |
| Preparation method: | Escherichia coli (E. coli) expression system |
| Storage buffer: | In 20 mM Tris-HCl, pH 8.0 (10% glycerol) |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Loading 3 ug protein in 15% SDS-PAGE |
| Tag: | None |
| Shipping condition: | Dry Ice |