| Reference: | P4966 |
| Product name: | dnaK (Escherichia coli (E. coli)) Recombinant protein |
| Product description: | Escherichia coli (E. coli) dnaK (NP_414555, 508 a.a. - 638 a.a.) partial recombinant protein expressed in Escherichia coli (E. coli). |
| Gene id: | 944750 |
| Gene name: | dnaK |
| Gene alias: | ECK0014|JW0013|groPAB|groPC|groPF|grpC|grpF|seg |
| Gene description: | chaperone Hsp70, co-chaperone with DnaJ |
| Immunogen sequence/protein sequence: | MNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQQHAQQQTAGADASANNAKDDDVVDAEFEEVKDKK |
| Protein accession: | NP_414555 |
| Form: | Liquid |
| Concentration: | 1 mg/mL |
| Preparation method: | Escherichia coli (E. coli) expression system |
| Storage buffer: | In 25 mM Tris-HCl, 100 mM NaCl, pH 7.5. (1 mM DTT, 10% glycerol) |
| Storage instruction: | Store at -20°C. For long term storage store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 15% SDS-PAGE Stained with Coomassie Blue |
| Tag: | None |
| Shipping condition: | Dry Ice |