Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of msrB (Escherichia coli (E. coli)) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Origin species | Escherichia coli (E. coli) |
| Host species | Escherichia coli (E. coli) |
| Applications | SDS-PAGE |
More info about msrB (Escherichia coli (E. coli)) Recombinant Protein
| Reference: | P4999 |
| Product name: | msrB (Escherichia coli (E. coli)) Recombinant Protein |
| Product description: | Escherichia coli (E. coli) msrB (NP_416292, 1 a.a. - 137 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli (E. coli). |
| Gene id: | 947188 |
| Gene name: | msrB |
| Gene alias: | ECK1776|JW1767|yeaA |
| Gene description: | methionine sulfoxide reductase B |
| Immunogen sequence/protein sequence: | MGSSHHHHHHSSGLVPRGSHMANKPSAEELKKNLSEMQFYVTQNHGTEPPFTGRLLHNKRDGVYHCLICDAPLFHSQTKYDSGCGWPSFYEPVSEESIRYIKDLSHGMQRIEIRCGNCDAHLGHVFPDGPQPTGERYCVNSASLRFTDGENGEEING |
| Protein accession: | NP_416292 |
| Form: | Liquid |
| Concentration: | 1 mg/mL |
| Preparation method: | Escherichia coli (E. coli) expression system |
| Storage buffer: | In 20 mM Tris-HCl, 100 mM NaCl, pH 8.0 (20% glycerol, 1 mM DTT) |
| Storage instruction: | Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Loading 3 ug protein in 15% SDS-PAGE |
| Tag: | His |
| Shipping condition: | Dry Ice |