Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
View larger 
Data sheet of Maltose Binding Protein (Escherichia coli (E. coli)) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Origin species | Escherichia coli (E. coli) |
| Host species | Escherichia coli (E. coli) |
| Applications | SDS-PAGE |
More info about Maltose Binding Protein (Escherichia coli (E. coli)) Recombinant Protein
| Reference: | P4989 |
| Product name: | Maltose Binding Protein (Escherichia coli (E. coli)) Recombinant Protein |
| Product description: | Escherichia coli (E. coli) Maltose Binding Protein (1 a.a. - 387 a.a.) full-length recombinant protein expressed in Escherichia coli (E. coli). |
| Immunogen sequence/protein sequence: | MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSSNNNNNNNNNNLGIEGR |
| Form: | Liquid |
| Concentration: | 1 mg/mL |
| Preparation method: | Escherichia coli (E. coli) expression system |
| Storage buffer: | In 20 mM Tris, pH 8.0 |
| Storage instruction: | Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Loading 3 ug protein in 15% SDS-PAGE |
| Tag: | None |
| Shipping condition: | Dry Ice |