Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of LOXL4 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Host species | Mouse |
| Applications | ELISA |
More info about LOXL4 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00084171-A01 |
| Product name: | LOXL4 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant LOXL4. |
| Gene id: | 84171 |
| Gene name: | LOXL4 |
| Gene alias: | FLJ21889|LOXC |
| Gene description: | lysyl oxidase-like 4 |
| Genbank accession: | NM_032211 |
| Immunogen: | LOXL4 (NP_115587, 657 a.a. ~ 755 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | ACANFGEQGVTVGCWDTYRHDIDCQWVDITDVGPGNYIFQVIVNPHYEVAESDFSNNMLQCRCKYDGHRVWLHNCHTGNSYPANAELSLEQEQRLRNNL |
| Protein accession: | NP_115587 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |
| Publications: | Lysyl oxidase-like 4 is alternatively spliced in an anatomic site-specific manner in tumors involving the serosal cavities.Sebban S, Davidson B, Reich R. Virchows Arch. 2009 Jan;454(1):71-9. Epub 2008 Nov 18. |