| Brand: | Abnova |
| Reference: | H00084164-A01 |
| Product name: | ASCC2 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant ASCC2. |
| Gene id: | 84164 |
| Gene name: | ASCC2 |
| Gene alias: | ASC1p100 |
| Gene description: | activating signal cointegrator 1 complex subunit 2 |
| Genbank accession: | NM_032204 |
| Immunogen: | ASCC2 (NP_115580, 672 a.a. ~ 757 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | APKPDHFVQDPAVLREKAEARRMAFLAKKGYRHDSSTAVAGSPRGHGQSRETTQERRKKEANKATRANHNRRTMADRKRSKGMIPS |
| Protein accession: | NP_115580 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.57 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |