No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00084152-B01P |
Product name: | PPP1R1B purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human PPP1R1B protein. |
Gene id: | 84152 |
Gene name: | PPP1R1B |
Gene alias: | DARPP-32|DARPP32|FLJ20940 |
Gene description: | protein phosphatase 1, regulatory (inhibitor) subunit 1B |
Genbank accession: | NM_032192.2 |
Immunogen: | PPP1R1B (NP_115568.2, 1 a.a. ~ 204 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPAMLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGYPREEDEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPALSEPGEEPQRPSPSEPGT |
Protein accession: | NP_115568.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of PPP1R1B expression in transfected 293T cell line (H00084152-T01) by PPP1R1B MaxPab polyclonal antibody. Lane 1: PPP1R1B transfected lysate(22.44 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |