No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,S-ELISA,ELISA |
Brand: | Abnova |
Reference: | H00084108-M01 |
Product name: | PCGF6 monoclonal antibody (M01), clone 2B8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PCGF6. |
Clone: | 2B8 |
Isotype: | IgG2b Kappa |
Gene id: | 84108 |
Gene name: | PCGF6 |
Gene alias: | MBLR|MGC15678|MGC17541|RNF134 |
Gene description: | polycomb group ring finger 6 |
Genbank accession: | NM_001011663 |
Immunogen: | PCGF6 (NP_001011663, 225 a.a. ~ 324 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | AVPQPVPSSKGRSKKVLESVFRIPPELDMSLLLEFIGANEGTGHFKPLEKKFVRVSGEATIGHVEKFLRRKMGLDPACQVDIICGDHLLEQYQTLREIRR |
Protein accession: | NP_001011663 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged PCGF6 is 1 ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA |
Shipping condition: | Dry Ice |