Cart 22 Product Products 6 909,50 € (empty)
Product successfully added to your shopping cart
Quantity
Total
There are 22 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 6 909,50 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 6 909,50 €
Data sheet of FAM119B purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about FAM119B purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00025895-B01P |
| Product name: | FAM119B purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human FAM119B protein. |
| Gene id: | 25895 |
| Gene name: | FAM119B |
| Gene alias: | DKFZp586D0919 |
| Gene description: | family with sequence similarity 119, member B |
| Genbank accession: | NM_015433.2 |
| Immunogen: | FAM119B (NP_056248.2, 1 a.a. ~ 226 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MADPGPDPESESESVFPREVGLFADSYSEKSQFCFCGHVLTITQNFGSRLGVAARVWDAALSLCNYFESQNVDFRGKKVIELGAGTGIVGILAALQGGDVTITDLPLALEQIQGNVQANVPAGGQAQVRALSWGIDHHVFPANYDLVLGADIVYLEPTFPLLLGTLQHLCRPHGTIYLASKMRKEHGTESFFQHLLPQHFQLELAQRDEDENVNIYRARHREPRPA |
| Protein accession: | NP_056248.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of FAM119B expression in transfected 293T cell line (H00025895-T01) by FAM119B MaxPab polyclonal antibody. Lane 1: DKFZP586D0919 transfected lysate(24.86 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |