No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00023112-M02 |
| Product name: | TNRC6B monoclonal antibody (M02), clone 4B11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TNRC6B. |
| Clone: | 4B11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 23112 |
| Gene name: | TNRC6B |
| Gene alias: | KIAA1093 |
| Gene description: | trinucleotide repeat containing 6B |
| Genbank accession: | NM_015088 |
| Immunogen: | TNRC6B (NP_055903, 253 a.a. ~ 352 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | ECNLGVWKSDPKAKSVQSSNSTTENNNGLGNWRNVSGQDRIGPGSGFSNFNPNSNPSAWPALVQEGTSRKGALETDNSNSSAQVSTVGQTSREQQSKMEN |
| Protein accession: | NP_055903 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.00 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |