TNRC6B monoclonal antibody (M02), clone 4B11 View larger

TNRC6B monoclonal antibody (M02), clone 4B11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TNRC6B monoclonal antibody (M02), clone 4B11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about TNRC6B monoclonal antibody (M02), clone 4B11

Brand: Abnova
Reference: H00023112-M02
Product name: TNRC6B monoclonal antibody (M02), clone 4B11
Product description: Mouse monoclonal antibody raised against a partial recombinant TNRC6B.
Clone: 4B11
Isotype: IgG2a Kappa
Gene id: 23112
Gene name: TNRC6B
Gene alias: KIAA1093
Gene description: trinucleotide repeat containing 6B
Genbank accession: NM_015088
Immunogen: TNRC6B (NP_055903, 253 a.a. ~ 352 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ECNLGVWKSDPKAKSVQSSNSTTENNNGLGNWRNVSGQDRIGPGSGFSNFNPNSNPSAWPALVQEGTSRKGALETDNSNSSAQVSTVGQTSREQQSKMEN
Protein accession: NP_055903
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00023112-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.00 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TNRC6B monoclonal antibody (M02), clone 4B11 now

Add to cart