Brand: | Abnova |
Reference: | H00023112-M02 |
Product name: | TNRC6B monoclonal antibody (M02), clone 4B11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TNRC6B. |
Clone: | 4B11 |
Isotype: | IgG2a Kappa |
Gene id: | 23112 |
Gene name: | TNRC6B |
Gene alias: | KIAA1093 |
Gene description: | trinucleotide repeat containing 6B |
Genbank accession: | NM_015088 |
Immunogen: | TNRC6B (NP_055903, 253 a.a. ~ 352 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | ECNLGVWKSDPKAKSVQSSNSTTENNNGLGNWRNVSGQDRIGPGSGFSNFNPNSNPSAWPALVQEGTSRKGALETDNSNSSAQVSTVGQTSREQQSKMEN |
Protein accession: | NP_055903 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.00 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |