Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00028227-B01 |
Product name: | PPP2R3B MaxPab mouse polyclonal antibody (B01) |
Product description: | Mouse polyclonal antibody raised against a full-length human PPP2R3B protein. |
Gene id: | 28227 |
Gene name: | PPP2R3B |
Gene alias: | NY-REN-8|PPP2R3L|PPP2R3LY|PR48 |
Gene description: | protein phosphatase 2 (formerly 2A), regulatory subunit B'', beta |
Genbank accession: | BC011180 |
Immunogen: | PPP2R3B (AAH11180.1, 1 a.a. ~ 225 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MIDRIFSGAVTRGRKVQKEGKISYADFVWFLISEEDKKTPTSIEYWFRCMDLDGDGALSMFELEYFYEEQCRRLDSMAIEALPFQDCLCQMLDLVKPRTEGKITLQDLKRCKLANVFFDTFFNIEKYLDHEQKEQISLLRDGDSGGPELSDWEKYAAEEYDILVAEETAGEPWEDGFEAELSPVEQKLSALRSPLAQRPFFEAPSPLGAVDLYEYACGDEDLEPL |
Protein accession: | AAH11180.1 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of PPP2R3B expression in transfected 293T cell line (H00028227-T01) by PPP2R3B MaxPab polyclonal antibody. Lane 1: PPP2R3B transfected lysate(24.86 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |