View larger

FECH monoclonal antibody (M07), clone 3H3

Reference:

Condition: New product

Data sheet of FECH monoclonal antibody (M07), clone 3H3

Brand:	Abnova
Reference:	H00002235-M07
Product name:	FECH monoclonal antibody (M07), clone 3H3
Product description:	Mouse monoclonal antibody raised against a partial recombinant FECH.
Clone:	3H3
Isotype:	IgG2b Kappa
Gene id:	2235
Gene name:	FECH
Gene alias:	EPP\|FCE
Gene description:	ferrochelatase (protoporphyria)
Genbank accession:	NM_000140
Immunogen:	FECH (NP_000131, 314 a.a. ~ 423 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence:	QTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL
Protein accession:	NP_000131
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Detection limit for recombinant GST tagged FECH is 0.03 ng/ml as a capture antibody.
Applications:	S-ELISA,ELISA
Shipping condition:	Dry Ice