| Brand: | Abnova |
| Reference: | H00029089-M01 |
| Product name: | UBE2T monoclonal antibody (M01), clone 1E12-4A3 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant UBE2T. |
| Clone: | 1E12-4A3 |
| Isotype: | IgG2b kappa |
| Gene id: | 29089 |
| Gene name: | UBE2T |
| Gene alias: | HSPC150|PIG50 |
| Gene description: | ubiquitin-conjugating enzyme E2T (putative) |
| Genbank accession: | BC004152 |
| Immunogen: | UBE2T (AAH04152, 1 a.a. ~ 197 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRFLTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFLKNARQWTEKHARQKQKADEEEMLDNLPEAGDSRVHNSTQKRKASQLVGIEKKFHPDV |
| Protein accession: | AAH04152 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (47.41 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | UBE2T monoclonal antibody (M01), clone 1E12-4A3 Western Blot analysis of UBE2T expression in Hela ( Cat # L013V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,IP |
| Shipping condition: | Dry Ice |
| Publications: | Hypoxia disrupts the Fanconi anemia pathway and sensitizes cells to chemotherapy through regulation of UBE2T.Ramaekers CH, van den Beucken T, Meng A, Kassam S, Thoms J, Bristow RG, Wouters BG. Radiother Oncol. 2011 Jun 29. [Epub ahead of print] |