Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of GZMB monoclonal antibody (M01), clone 4F5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,IP |
More info about GZMB monoclonal antibody (M01), clone 4F5
| Brand: | Abnova |
| Reference: | H00003002-M01 |
| Product name: | GZMB monoclonal antibody (M01), clone 4F5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant GZMB. |
| Clone: | 4F5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 3002 |
| Gene name: | GZMB |
| Gene alias: | CCPI|CGL-1|CGL1|CSP-B|CSPB|CTLA1|CTSGL1|HLP|SECT |
| Gene description: | granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1) |
| Genbank accession: | BC030195 |
| Immunogen: | GZMB (AAH30195, 148 a.a. ~ 247 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRH |
| Protein accession: | AAH30195 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoprecipitation of GZMB transfected lysate using anti-GZMB monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with GZMB MaxPab rabbit polyclonal antibody. |
| Applications: | S-ELISA,ELISA,WB-Re,IP |
| Shipping condition: | Dry Ice |