Brand: | Abnova |
Reference: | H00010328-B01 |
Product name: | COX4NB MaxPab mouse polyclonal antibody (B01) |
Product description: | Mouse polyclonal antibody raised against a full-length human COX4NB protein. |
Gene id: | 10328 |
Gene name: | COX4NB |
Gene alias: | C16orf2|C16orf4|FAM158B|NOC4 |
Gene description: | COX4 neighbor |
Genbank accession: | NM_006067.3 |
Immunogen: | COX4NB (NP_006058.1, 1 a.a. ~ 210 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MPGVKLTTQAYCKMVLHGAKYPHCAVNGLLVAEKQKPRKEHLPLGGPGAHHTLFVDCIPLFHGTLALAPMLEVALTLIDSWCKDHSYVIAGYYQANERVKDASPNQVAEKVASRIAEGFSDTALIMVDNTKFTMDCVAPTIHVYEHHENRWRCRDPHHDYCEDWPEAQRISASLLDSRSYETLVDFDNHLDDIRNDWTNPEINKAVLHLC |
Protein accession: | NP_006058.1 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | COX4NB MaxPab polyclonal antibody. Western Blot analysis of COX4NB expression in human placenta. |
Applications: | WB-Ti,IF,WB-Tr |
Shipping condition: | Dry Ice |