No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA |
Brand: | Abnova |
Reference: | H00003569-M14 |
Product name: | IL6 monoclonal antibody (M14), clone 4H1 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant IL6. |
Clone: | 4H1 |
Isotype: | IgG2a Kappa |
Gene id: | 3569 |
Gene name: | IL6 |
Gene alias: | BSF2|HGF|HSF|IFNB2|IL-6 |
Gene description: | interleukin 6 (interferon, beta 2) |
Genbank accession: | BC015511 |
Immunogen: | IL6 (AAH15511, 1 a.a. ~ 213 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM* |
Protein accession: | AAH15511 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |