| Brand: | Abnova |
| Reference: | H00010328-B01P |
| Product name: | COX4NB purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human COX4NB protein. |
| Gene id: | 10328 |
| Gene name: | COX4NB |
| Gene alias: | C16orf2|C16orf4|FAM158B|NOC4 |
| Gene description: | COX4 neighbor |
| Genbank accession: | NM_006067.3 |
| Immunogen: | COX4NB (NP_006058.1, 1 a.a. ~ 210 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MPGVKLTTQAYCKMVLHGAKYPHCAVNGLLVAEKQKPRKEHLPLGGPGAHHTLFVDCIPLFHGTLALAPMLEVALTLIDSWCKDHSYVIAGYYQANERVKDASPNQVAEKVASRIAEGFSDTALIMVDNTKFTMDCVAPTIHVYEHHENRWRCRDPHHDYCEDWPEAQRISASLLDSRSYETLVDFDNHLDDIRNDWTNPEINKAVLHLC |
| Protein accession: | NP_006058.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | COX4NB MaxPab polyclonal antibody. Western Blot analysis of COX4NB expression in human placenta. |
| Applications: | WB-Ti,IF,WB-Tr |
| Shipping condition: | Dry Ice |