Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MRPS27 monoclonal antibody (M14A), clone 3G8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about MRPS27 monoclonal antibody (M14A), clone 3G8
| Brand: | Abnova |
| Reference: | H00023107-M14A |
| Product name: | MRPS27 monoclonal antibody (M14A), clone 3G8 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant MRPS27. |
| Clone: | 3G8 |
| Isotype: | IgM Kappa |
| Gene id: | 23107 |
| Gene name: | MRPS27 |
| Gene alias: | FLJ21764|FLJ23348|KIAA0264|MRP-S27|S27mt |
| Gene description: | mitochondrial ribosomal protein S27 |
| Genbank accession: | BC030521 |
| Immunogen: | MRPS27 (AAH30521, 51 a.a. ~ 168 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SEEQSQNDEDNQGSEKLVEQLDIEETEQSKLPQYLERFKALHSKLQALGKIESEGLLSLTTQLVKEKLSTCEAEDIATYEQNLQQWHLDLVQLIQREQQQREQAKQEYQAQKAAKASA |
| Protein accession: | AAH30521 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.72 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | MRPS27 monoclonal antibody (M14A), clone 3G8 Western Blot analysis of MRPS27 expression in A-431 ( Cat # L015V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |