No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00023107-M14A |
Product name: | MRPS27 monoclonal antibody (M14A), clone 3G8 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant MRPS27. |
Clone: | 3G8 |
Isotype: | IgM Kappa |
Gene id: | 23107 |
Gene name: | MRPS27 |
Gene alias: | FLJ21764|FLJ23348|KIAA0264|MRP-S27|S27mt |
Gene description: | mitochondrial ribosomal protein S27 |
Genbank accession: | BC030521 |
Immunogen: | MRPS27 (AAH30521, 51 a.a. ~ 168 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SEEQSQNDEDNQGSEKLVEQLDIEETEQSKLPQYLERFKALHSKLQALGKIESEGLLSLTTQLVKEKLSTCEAEDIATYEQNLQQWHLDLVQLIQREQQQREQAKQEYQAQKAAKASA |
Protein accession: | AAH30521 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (38.72 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | MRPS27 monoclonal antibody (M14A), clone 3G8 Western Blot analysis of MRPS27 expression in A-431 ( Cat # L015V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |