| Brand: | Abnova |
| Reference: | H00010963-M06 |
| Product name: | STIP1 monoclonal antibody (M06), clone 1C6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant STIP1. |
| Clone: | 1C6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 10963 |
| Gene name: | STIP1 |
| Gene alias: | HOP|IEF-SSP-3521|P60|STI1|STI1L |
| Gene description: | stress-induced-phosphoprotein 1 |
| Genbank accession: | NM_006819 |
| Immunogen: | STIP1 (NP_006810.1, 445 a.a. ~ 543 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR |
| Protein accession: | NP_006810.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | STIP1 monoclonal antibody (M06), clone 1C6. Western Blot analysis of STIP1 expression in Raw 264.7. |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Secreted Stress-Induced Phosphoprotein 1 Activates the ALK2-SMAD Signaling Pathways and Promotes Cell Proliferation of Ovarian Cancer Cells.Tsai CL, Tsai CN, Lin CY, Chen HW, Lee YS, Chao A, Wang TH, Wang HS, Lai CH. Cell Rep. 2012 Aug 30;2(2):283-93. Epub 2012 Aug 9. |