No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00009246-M01A |
| Product name: | UBE2L6 monoclonal antibody (M01A), clone S1 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant UBE2L6. |
| Clone: | S1 |
| Isotype: | IgG1 Kappa |
| Gene id: | 9246 |
| Gene name: | UBE2L6 |
| Gene alias: | MGC40331|RIG-B|UBCH8 |
| Gene description: | ubiquitin-conjugating enzyme E2L 6 |
| Genbank accession: | BC032491 |
| Immunogen: | UBE2L6 (AAH32491, 1 a.a. ~ 153 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MMASMRVVKELEDLQKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRPS |
| Protein accession: | AAH32491 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (42.57 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |