| Brand:  | Abnova | 
| Reference:  | H00009246-M01A | 
| Product name:  | UBE2L6 monoclonal antibody (M01A), clone S1 | 
| Product description:  | Mouse monoclonal antibody raised against a full-length recombinant UBE2L6. | 
| Clone:  | S1 | 
| Isotype:  | IgG1 Kappa | 
| Gene id:  | 9246 | 
| Gene name:  | UBE2L6 | 
| Gene alias:  | MGC40331|RIG-B|UBCH8 | 
| Gene description:  | ubiquitin-conjugating enzyme E2L 6 | 
| Genbank accession:  | BC032491 | 
| Immunogen:  | UBE2L6 (AAH32491, 1 a.a. ~ 153 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | MMASMRVVKELEDLQKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRPS | 
| Protein accession:  | AAH32491 | 
| Storage buffer:  | In ascites fluid | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (42.57 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Applications:  | ELISA,WB-Re | 
| Shipping condition:  | Dry Ice |