Cart 11 Product Products 4 335,00 € (empty)
No products
To be determined Shipping
4 335,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 11 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 4 335,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 4 335,00 €
Data sheet of MYCN monoclonal antibody (M01), clone 3H4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
More info about MYCN monoclonal antibody (M01), clone 3H4
| Brand: | Abnova |
| Reference: | H00004613-M01 |
| Product name: | MYCN monoclonal antibody (M01), clone 3H4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MYCN. |
| Clone: | 3H4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 4613 |
| Gene name: | MYCN |
| Gene alias: | MODED|N-myc|NMYC|ODED|bHLHe37 |
| Gene description: | v-myc myelocytomatosis viral related oncogene, neuroblastoma derived (avian) |
| Genbank accession: | NM_005378 |
| Immunogen: | MYCN (NP_005369, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MPSCSTSTMPGMICKNPDLEFDSLQPCFYPDEDDFYFGGPDSTPPGEDIWKKFELLPTPPLSPSRGFAEHSSEPPSWVTEMLLENELWGSPAEEDAFGLG |
| Protein accession: | NP_005369 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | MYCN monoclonal antibody (M01), clone 3H4 Western Blot analysis of MYCN expression in HepG2 ( Cat # L019V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |