| Brand: | Abnova |
| Reference: | H00003960-M01 |
| Product name: | LGALS4 monoclonal antibody (M01), clone 1E8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant LGALS4. |
| Clone: | 1E8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 3960 |
| Gene name: | LGALS4 |
| Gene alias: | GAL4|L36LBP |
| Gene description: | lectin, galactoside-binding, soluble, 4 |
| Genbank accession: | NM_006149 |
| Immunogen: | LGALS4 (NP_006140, 51 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | VVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFI |
| Protein accession: | NP_006140 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to LGALS4 on formalin-fixed paraffin-embedded human ovarian cancer. [antibody concentration 3 ug/ml] |
| Applications: | IHC-P,ELISA,WB-Re |
| Shipping condition: | Dry Ice |