Product successfully added to your shopping cart
Quantity
Total
There are 3 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 1 037,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 1 037,00 €
Data sheet of BRF1 monoclonal antibody (M01A), clone 2E9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about BRF1 monoclonal antibody (M01A), clone 2E9
| Brand: | Abnova |
| Reference: | H00002972-M01A |
| Product name: | BRF1 monoclonal antibody (M01A), clone 2E9 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant BRF1. |
| Clone: | 2E9 |
| Isotype: | IgG1 Kappa |
| Gene id: | 2972 |
| Gene name: | BRF1 |
| Gene alias: | BRF|FLJ42674|FLJ43034|GTF3B|MGC105048|TAF3B2|TAF3C|TAFIII90|TF3B90|TFIIIB90|hBRF |
| Gene description: | BRF1 homolog, subunit of RNA polymerase III transcription initiation factor IIIB (S. cerevisiae) |
| Genbank accession: | BC016743 |
| Immunogen: | BRF1 (AAH16743, 1 a.a. ~ 208 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MTGRVCRGCGGTDIELDAARGDTVCTACGSVLEDNIIMSEVQFVESSGGGSSAVGQFVSLDGAGKTPTLGGGFHVNLGKESRAQTLQNGRRHIHHLGNQLQLNQHCLDTAFNFFKMAVSRHLTRGRKMAHVIAACLYPVCRTEGTPHMLLDLSDLLQVDSLRPASFPTWGCDLGVVTRVVTGVYPRCLHASQWPVCAACPVRKFWSVG |
| Protein accession: | AAH16743 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (48.62 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |