No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00170685-M01 |
| Product name: | NUDT10 monoclonal antibody (M01), clone 2F8 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant NUDT10. |
| Clone: | 2F8 |
| Isotype: | IgG2b Kappa |
| Gene id: | 170685 |
| Gene name: | NUDT10 |
| Gene alias: | APS2|DIPP3a|hDIPP3alpha |
| Gene description: | nudix (nucleoside diphosphate linked moiety X)-type motif 10 |
| Genbank accession: | BC049383 |
| Immunogen: | NUDT10 (AAH49383, 1 a.a. ~ 164 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MKCKPNQTRTYDPEGFKKRAACLCFRSEREDEVLLVSSSRYPDRWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGVFEQNQDPKHRTYVYVLTVTELLEDWEDSVSIGRKREWFKVEDAIKVLQCHKPMHAEYLEKLKLGGSPTNGNSMAPSSPDSDP |
| Protein accession: | AAH49383 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (43.78 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Detection limit for recombinant GST tagged NUDT10 is approximately 1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |