| Brand: | Abnova |
| Reference: | H00057459-M01 |
| Product name: | GATAD2B monoclonal antibody (M01), clone 4G10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant GATAD2B. |
| Clone: | 4G10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 57459 |
| Gene name: | GATAD2B |
| Gene alias: | FLJ37346|KIAA1150|MGC138257|MGC138285|P66beta|RP11-216N14.6 |
| Gene description: | GATA zinc finger domain containing 2B |
| Genbank accession: | NM_020699 |
| Immunogen: | GATAD2B (NP_065750, 3 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RMTEDALRLNLLKRSLDPADERDDVLAKRLKMEGHEAMERLKMLALLKRKDLANLEVPHELPTKQDGSGVKGYEEKLNGNLRPHGDNRTAGRPGKENINDEPVDMSAR |
| Protein accession: | NP_065750 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.62 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | GATAD2B monoclonal antibody (M01), clone 4G10 Western Blot analysis of GATAD2B expression in Jurkat ( Cat # L017V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |