No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00026353-M04A |
| Product name: | HSPB8 monoclonal antibody (M04A), clone 5B12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant HSPB8. |
| Clone: | 5B12 |
| Isotype: | IgG2a Kappa |
| Gene id: | 26353 |
| Gene name: | HSPB8 |
| Gene alias: | CMT2L|DHMN2|E2IG1|H11|HMN2|HMN2A|HSP22 |
| Gene description: | heat shock 22kDa protein 8 |
| Genbank accession: | NM_014365 |
| Immunogen: | HSPB8 (NP_055180, 97 a.a. ~ 196 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSTFGESSFNNELPQDSQEVTCT |
| Protein accession: | NP_055180 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of HSPB8 expression in transfected 293T cell line by HSPB8 monoclonal antibody (M04A), clone 5B12. Lane 1: HSPB8 transfected lysate(35.446 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |