| Brand: | Abnova |
| Reference: | H00010715-M01 |
| Product name: | LASS1 monoclonal antibody (M01), clone 2E8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant LASS1. |
| Clone: | 2E8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 10715 |
| Gene name: | LASS1 |
| Gene alias: | CerS1|LAG1|MGC90349|UOG1 |
| Gene description: | LAG1 homolog, ceramide synthase 1 |
| Genbank accession: | NM_021267 |
| Immunogen: | LASS1 (NP_067090.1, 301 a.a. ~ 350 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | YIVAFAAKVLTGQVHELKDLREYDTAEAQSLKPSKAEKPLRNGLVKDKRF |
| Protein accession: | NP_067090.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (31.24 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |