NCF4 purified MaxPab rabbit polyclonal antibody (D01P) View larger

NCF4 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NCF4 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIF,WB-Tr

More info about NCF4 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00004689-D01P
Product name: NCF4 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human NCF4 protein.
Gene id: 4689
Gene name: NCF4
Gene alias: MGC3810|NCF|P40PHOX|SH3PXD4
Gene description: neutrophil cytosolic factor 4, 40kDa
Genbank accession: NM_000631
Immunogen: NCF4 (NP_000622.2, 1 a.a. ~ 339 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAVAQQLRAESDFEQLPDDVAISANIADIEEKRGFTSHFVFVIEVKTKGGSKYLIYRRYRQFHALQSKLEERFGPDSKSSALACTLPTLPAKVYVGVKQEIAEMRIPALNAYMKSLLSLPVWVLMDEDVRIFFYQSPYDSEQVPQALRRLRPRTRKVKSVSPQGNSVDRMAAPRAEALFDFTGNSKLELNFKAGDVIFLLSRINKDWLEGTVRGATGIFPLSFVKILKDFPEEDDPTNWLRCYYYEDTISTIKDIAVEEDLSSTPLLKDLLELTRREFQREDIALNYRDAEGDLVRLLSDEDVALMVRQARGLPSQKRLFPWKLHITQKDNYRVYNTMP
Protein accession: NP_000622.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00004689-D01P-13-15-1.jpg
Application image note: Western Blot analysis of NCF4 expression in transfected 293T cell line (H00004689-T02) by NCF4 MaxPab polyclonal antibody.

Lane 1: NCF4 transfected lysate(39.00 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy NCF4 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart