Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CSTF3 monoclonal antibody (M01), clone 1D4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
More info about CSTF3 monoclonal antibody (M01), clone 1D4
| Brand: | Abnova |
| Reference: | H00001479-M01 |
| Product name: | CSTF3 monoclonal antibody (M01), clone 1D4 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant CSTF3. |
| Clone: | 1D4 |
| Isotype: | IgG1 kappa |
| Gene id: | 1479 |
| Gene name: | CSTF3 |
| Gene alias: | CSTF-77|MGC117398|MGC43001|MGC75122 |
| Gene description: | cleavage stimulation factor, 3' pre-RNA, subunit 3, 77kDa |
| Genbank accession: | BC009792 |
| Immunogen: | CSTF3 (AAH09792, 1 a.a. ~ 103 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSGDGATEQAAEYVPEKVKKAEKKLEENPYDLDAWSILIREAQNQPIDKARKTYERLVAQFPSSGRFWKLYIEAEVTILFYFFLYQYCSIHCSDRKQVRNIAN |
| Protein accession: | AAH09792 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.07 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to CSTF3 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml] |
| Applications: | IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |
| Publications: | Polyadenylation site-specific differences in the activity of the neuronal βCstF-64 protein in PC-12 cells.Shankarling GS, Macdonald CC. Gene. 2013 Oct 25;529(2):220-7. |