| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,PLA-Ce |
| Brand: | Abnova |
| Reference: | H00004296-M02 |
| Product name: | MAP3K11 monoclonal antibody (M02), clone 3D11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MAP3K11. |
| Clone: | 3D11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 4296 |
| Gene name: | MAP3K11 |
| Gene alias: | MGC17114|MLK-3|MLK3|PTK1|SPRK |
| Gene description: | mitogen-activated protein kinase kinase kinase 11 |
| Genbank accession: | NM_002419 |
| Immunogen: | MAP3K11 (NP_002410, 741 a.a. ~ 847 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PPPGTSRSAPGTPGTPRSPPLGLISRPRPSPLRSRIDPWSFVSAGPRPSPLPSPQPAPRRAPWTLFPDSDPFWDSPPANPFQGGPQDCRAQTKDMGAQAPWVPEAGP |
| Protein accession: | NP_002410 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.51 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of MAP3K11 expression in transfected 293T cell line by MAP3K11 monoclonal antibody (M02), clone 3D11. Lane 1: MAP3K11 transfected lysate(92.7 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,PLA-Ce |
| Shipping condition: | Dry Ice |