| Brand: | Abnova |
| Reference: | H00011333-M05 |
| Product name: | PDAP1 monoclonal antibody (M05), clone 3B10 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant PDAP1. |
| Clone: | 3B10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 11333 |
| Gene name: | PDAP1 |
| Gene alias: | HASPP28|PAP|PAP1 |
| Gene description: | PDGFA associated protein 1 |
| Genbank accession: | BC000684 |
| Immunogen: | PDAP1 (AAH00684, 1 a.a. ~ 181 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MPKGGRKGGHKGRARQYTSPEEIDAQLQAEKQKAREEEEQKEGGDGAAGDPKKEKKSLDSDESEDEEDDYQQKRKGVEGLIDIENPNRVAQTTKKVTQLDLDGPKELSRREREEIEKQKAKERYMKMHLAGKTEQAKADLARLAIIRKQREEAARKKEEERKAKDDATLSGKRMQSLSLNK |
| Protein accession: | AAH00684 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (45.65 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged PDAP1 is 0.3 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |