| Brand: | Abnova |
| Reference: | H00010574-M01 |
| Product name: | CCT7 monoclonal antibody (M01), clone 1D6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CCT7. |
| Clone: | 1D6 |
| Isotype: | IgG1 kappa |
| Gene id: | 10574 |
| Gene name: | CCT7 |
| Gene alias: | CCT-ETA|Ccth|MGC110985|Nip7-1|TCP-1-eta |
| Gene description: | chaperonin containing TCP1, subunit 7 (eta) |
| Genbank accession: | BC019296 |
| Immunogen: | CCT7 (AAH19296, 425 a.a. ~ 528 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RTIPGKQQLLIGAYAKALEIIPRQLCDNAGFDATNILNKLRARHAQGGTWYGVDINNEDIADNFEAFVWEPAMVRINALTAASEAACLIVSVDETIKNPRSTVD |
| Protein accession: | AAH19296 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.07 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | CCT7 monoclonal antibody (M01), clone 1D6 Western Blot analysis of CCT7 expression in HL-60 ( Cat # L014V1 ). |
| Applications: | WB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | TRiC controls transcription resumption after UV damage by regulating Cockayne syndrome protein A.Pines A, Dijk M, Makowski M, Meulenbroek EM, Vrouwe MG, van der Weegen Y, Baltissen M, French PJ, van Royen ME, Luijsterburg MS, Mullenders LH, Vermeulen M, Vermeulen W, Pannu NS, van Attikum H. Nat Commun. 2018 Mar 12;9(1):1040. |