Cart 2 Product Products 546,64 € (empty)
No products
To be determined Shipping
546,64 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 2 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 546,64 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 546,64 €
Data sheet of MRPL28 purified MaxPab mouse polyclonal antibody (B02P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,WB-Tr |
More info about MRPL28 purified MaxPab mouse polyclonal antibody (B02P)
| Brand: | Abnova |
| Reference: | H00010573-B02P |
| Product name: | MRPL28 purified MaxPab mouse polyclonal antibody (B02P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human MRPL28 protein. |
| Gene id: | 10573 |
| Gene name: | MRPL28 |
| Gene alias: | MAAT1|MGC8499|p15 |
| Gene description: | mitochondrial ribosomal protein L28 |
| Genbank accession: | NM_006428.3 |
| Immunogen: | MRPL28 (NP_006419.2, 1 a.a. ~ 256 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MPLHKYPVWLWKRLQLREGICSRLPGHYLRSLEEERTPTPVHYRPHGAKFKINPKNGQRERVEDVPIPIYFPPESQRGLWGGEGWILGQIYANNDKLSKRLKKVWKPQLFEREFYSEILDKKFTVTVTMRTLDLIDEAYGLDFYILKTPKEDLCSKFGMDLKRGMLLRLARQDPQLHPEDPERRAAIYDKYKEFAIPEEEAEWVGLTLEEAIEKQRLLEEKDPVPLFKIYVAELIQQLQQQALSEPAVVQKRASGQ |
| Protein accession: | NP_006419.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of MRPL28 expression in transfected 293T cell line (H00010573-T02) by MRPL28 MaxPab polyclonal antibody. Lane 1: MRPL28 transfected lysate(28.16 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |