Product successfully added to your shopping cart
Quantity
Total
There are 3 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 1 113,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 1 113,00 €
Data sheet of PTGES monoclonal antibody (M04A), clone 2B9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about PTGES monoclonal antibody (M04A), clone 2B9
| Brand: | Abnova |
| Reference: | H00009536-M04A |
| Product name: | PTGES monoclonal antibody (M04A), clone 2B9 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant PTGES. |
| Clone: | 2B9 |
| Isotype: | IgG2b Kappa |
| Gene id: | 9536 |
| Gene name: | PTGES |
| Gene alias: | MGC10317|MGST-IV|MGST1-L1|MGST1L1|MPGES|PGES|PIG12|PP102|PP1294|TP53I12|mPGES-1 |
| Gene description: | prostaglandin E synthase |
| Genbank accession: | BC008280 |
| Immunogen: | PTGES (AAH08280.1, 1 a.a. ~ 152 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL |
| Protein accession: | AAH08280.1 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |