Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PPP2R2C monoclonal antibody (M01), clone 6D1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about PPP2R2C monoclonal antibody (M01), clone 6D1
| Brand: | Abnova |
| Reference: | H00005522-M01 |
| Product name: | PPP2R2C monoclonal antibody (M01), clone 6D1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PPP2R2C. |
| Clone: | 6D1 |
| Isotype: | IgG1 Kappa |
| Gene id: | 5522 |
| Gene name: | PPP2R2C |
| Gene alias: | B55-GAMMA|IMYPNO|IMYPNO1|MGC33570|PR52|PR55G |
| Gene description: | protein phosphatase 2 (formerly 2A), regulatory subunit B, gamma isoform |
| Genbank accession: | NM_020416 |
| Immunogen: | PPP2R2C (NP_065149, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MGEDTDTRKINHSFLRDHSYVTEADIISTVEFNHTGELLATGDKGGRVVIFQREPESKNAPHSQGEYDVYSTFQSHEPEFDYLKSLEIEEKINKIKWLPQQNAAHSLLST |
| Protein accession: | NP_065149 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | PPP2R2C monoclonal antibody (M01), clone 6D1 Western Blot analysis of PPP2R2C expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Association of decreased expression of protein phosphatase 2A subunit PR55{gamma} (PPP2R2C) with an increased risk of metastases and prostate cancer-specific mortality.Spencer ES, Bluemn EG, Johnston R, Zhang X, Gordon RR, Lewinshtein D, Lucas J, Nelson P, Porter CR. J Clin Oncol (Meeting Abstracts) May 2012 vol. 30 no. 15_suppl 4669 |