Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ITPR1 monoclonal antibody (M01), clone 2B6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA |
More info about ITPR1 monoclonal antibody (M01), clone 2B6
| Brand: | Abnova |
| Reference: | H00003708-M01 |
| Product name: | ITPR1 monoclonal antibody (M01), clone 2B6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ITPR1. |
| Clone: | 2B6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 3708 |
| Gene name: | ITPR1 |
| Gene alias: | INSP3R1|IP3R|IP3R1|SCA15|SCA16 |
| Gene description: | inositol 1,4,5-triphosphate receptor, type 1 |
| Genbank accession: | NM_002222 |
| Immunogen: | ITPR1 (NP_002213, 2470 a.a. ~ 2577 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EHTCETLLMCIVTVLSHGLRSGGGVGDVLRKPSKEEPLFAARVIYDLLFFFMVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVTFEEHI |
| Protein accession: | NP_002213 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | http://www.abnova.com/application_image/ |
| Application image note: | Detection limit for recombinant GST tagged ITPR1 is approximately 10ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |
| Publications: | Microdomains of muscarinic acetylcholine and InsP3 receptors create InsP3 junctions and sites of Ca2+ wave initiation in smooth muscle.Olson ML, Sandison ME, Chalmers S, McCarron JG. J Cell Sci. 2012 Sep 3. |