| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Tr |
| Brand: | Abnova |
| Reference: | H00001912-M01 |
| Product name: | PHC2 monoclonal antibody (M01), clone 1F4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PHC2. |
| Clone: | 1F4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 1912 |
| Gene name: | PHC2 |
| Gene alias: | EDR2|HPH2|MGC163502|PH2 |
| Gene description: | polyhomeotic homolog 2 (Drosophila) |
| Genbank accession: | NM_004427 |
| Immunogen: | PHC2 (NP_004418.2, 91 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PYLQESKEEGAPLKLKCELCGRVDFAYKFKRSKRFCSMACAKRYNVGCTKRVGLFHSDRSKLQKAGAATHNRRRASKASLPPLTKDTKKQPTGTVPLSVTAALQLTHSQE |
| Protein accession: | NP_004418.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of PHC2 expression in transfected 293T cell line by PHC2 monoclonal antibody (M01), clone 1F4. Lane 1: PHC2 transfected lysate (Predicted MW: 35.8 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Tr |
| Shipping condition: | Dry Ice |