CTSD purified MaxPab mouse polyclonal antibody (B01P) View larger

CTSD purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CTSD purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,WB-Ti,WB-Tr

More info about CTSD purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00001509-B01P
Product name: CTSD purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human CTSD protein.
Gene id: 1509
Gene name: CTSD
Gene alias: CLN10|CPSD|MGC2311
Gene description: cathepsin D
Genbank accession: NM_001909
Immunogen: CTSD (AAH16320.1, 1 a.a. ~ 412 a.a) full-length human protein.
Immunogen sequence/protein sequence: MQPSSLLPLALCLLAAPASALVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL
Protein accession: AAH16320.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001509-B01P-13-15-1.jpg
Application image note: Western Blot analysis of CTSD expression in transfected 293T cell line (H00001509-T01) by CTSD MaxPab polyclonal antibody.

Lane 1: CTSD transfected lysate(45.32 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CTSD purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart