| Brand: | Abnova |
| Reference: | H00001045-M01 |
| Product name: | CDX2 monoclonal antibody (M01), clone 1C7 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant CDX2. |
| Clone: | 1C7 |
| Isotype: | IgG |
| Gene id: | 1045 |
| Gene name: | CDX2 |
| Gene alias: | CDX-3|CDX3 |
| Gene description: | caudal type homeobox 2 |
| Genbank accession: | BC014461 |
| Immunogen: | CDX2 (AAH14461.1, 1 a.a. ~ 313 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAAAAANLDSAQSPGPSWPAAYGAPLREDWNGYAPGGAAAAANAVAHGPNGGSPAAAMGYSSPADYHPHHHPHHHPHHPAAAPSCASGLLQTLNPGPPGPAATAAAEQLSPGGQRRNLCEWMRKPAQQSLGSQVKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKAELAATLGLSERQVKIWFQNRRAKERKINKKKLQQQQQQQPPQPPPPPPQPPQPQPGPLRSVPEPLSPVSSLQASVSGSVPGVLGPTGGVLNPTVTQ |
| Protein accession: | AAH14461.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (60.17 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | CDX2 monoclonal antibody (M01), clone 1C7. Western Blot analysis of CDX2 expression in human parotid gland. |
| Applications: | WB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Transcriptional control of the B3GALT5 gene by a retroviral promoter and methylation of distant regulatory elements.Zulueta A, Caretti A, Signorelli P FASEB J. 2013 Oct 15. |