CTCF monoclonal antibody, clone CL0304 View larger

CTCF monoclonal antibody, clone CL0304

New product

455,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CTCF monoclonal antibody, clone CL0304

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P

More info about CTCF monoclonal antibody, clone CL0304

Brand: Abnova
Reference: MAB15597
Product name: CTCF monoclonal antibody, clone CL0304
Product description: Mouse monoclonal antibody raised against partial recombinant human CTCF.
Clone: CL0304
Isotype: IgG2a
Gene id: 10664
Gene name: CTCF
Gene alias: -
Gene description: CCCTC-binding factor (zinc finger protein)
Immunogen: Recombinant protein corresponding to human CTCF.
Immunogen sequence/protein sequence: QNQTDGGEVVQDVNSSVQMVMMEQLDPTLLQMKTEVMEGTVAPEAEAAVDDTQIITLQVVNMEEQPINIGELQLVQVPVPVTVPVATTSVEELQGAYENEVSKEGLAESEPMICHTLPLPEGFQVVKVGANGEVETLEQGELPPQEDP
Protein accession: P49711
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-1:2500)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: MAB15597-46-187-1.jpg
Application image note: Western Blot analysis of U-251 MG cell lysate with CTCF monoclonal antibody, clone CL0304 (Cat # MAB15597).
Applications: WB-Ce,IHC-P
Shipping condition: Dry Ice
Publications: Antibodies biotinylated using a synthetic Z-domain from protein A provide stringent in situ protein detection.Andersson S, Konrad A, Ashok N, Ponten F, Hober S, Asplund A.
J Histochem Cytochem. 2013 Nov;61(11):773-84. doi: 10.1369/0022155413502360. Epub 2013 Aug 6.

Reviews

Buy CTCF monoclonal antibody, clone CL0304 now

Add to cart