No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
Brand: | Abnova |
Reference: | H00253260-M01 |
Product name: | RICTOR monoclonal antibody (M01), clone 1F3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RICTOR. |
Clone: | 1F3 |
Isotype: | IgG2b Kappa |
Gene id: | 253260 |
Gene name: | RICTOR |
Gene alias: | DKFZp686B11164|KIAA1999|MGC39830|mAVO3 |
Gene description: | rapamycin-insensitive companion of mTOR |
Genbank accession: | NM_152756 |
Immunogen: | RICTOR (NP_689969, 1 a.a. ~ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAAIGRGRSLKNLRVRGRNDSGEENVPLDLTREPSDNLREILQNVARLQGVSNMRKLGHLNNFTKLLCDIGHSEEKLGFHYEDIIICLRLALLNEAKE |
Protein accession: | NP_689969 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunoperoxidase of monoclonal antibody to RICTOR on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml] |
Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
Shipping condition: | Dry Ice |
Publications: | GNAQ and BRAF mutations show differential activation of the mTOR pathway in human transformed cells.Populo H, Tavares S, Faustino A, Nunes JB, Lopes JM, Soares P PeerJ. 2013 Jul 23;1:e104. doi: 10.7717/peerj.104. Print 2013. |