Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of RICTOR monoclonal antibody (M01), clone 1F3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
More info about RICTOR monoclonal antibody (M01), clone 1F3
| Brand: | Abnova |
| Reference: | H00253260-M01 |
| Product name: | RICTOR monoclonal antibody (M01), clone 1F3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RICTOR. |
| Clone: | 1F3 |
| Isotype: | IgG2b Kappa |
| Gene id: | 253260 |
| Gene name: | RICTOR |
| Gene alias: | DKFZp686B11164|KIAA1999|MGC39830|mAVO3 |
| Gene description: | rapamycin-insensitive companion of mTOR |
| Genbank accession: | NM_152756 |
| Immunogen: | RICTOR (NP_689969, 1 a.a. ~ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAAIGRGRSLKNLRVRGRNDSGEENVPLDLTREPSDNLREILQNVARLQGVSNMRKLGHLNNFTKLLCDIGHSEEKLGFHYEDIIICLRLALLNEAKE |
| Protein accession: | NP_689969 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to RICTOR on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |
| Publications: | GNAQ and BRAF mutations show differential activation of the mTOR pathway in human transformed cells.Populo H, Tavares S, Faustino A, Nunes JB, Lopes JM, Soares P PeerJ. 2013 Jul 23;1:e104. doi: 10.7717/peerj.104. Print 2013. |