No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Rabbit |
| Applications | WB-Ce,WB-Ti,WB-Tr,PLA-Ce |
| Brand: | Abnova |
| Reference: | H00059067-D01P |
| Product name: | IL21 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human IL21 protein. |
| Gene id: | 59067 |
| Gene name: | IL21 |
| Gene alias: | IL-21|Za11 |
| Gene description: | interleukin 21 |
| Genbank accession: | NM_021803 |
| Immunogen: | IL21 (NP_068575.1, 1 a.a. ~ 162 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MRSSPGNMERIVICLMVIFLGTLVHKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS |
| Protein accession: | NP_068575.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: | ![]() |
| Application image note: | IL21 MaxPab rabbit polyclonal antibody. Western Blot analysis of IL21 expression in human liver. |
| Applications: | WB-Ce,WB-Ti,WB-Tr,PLA-Ce |
| Shipping condition: | Dry Ice |