No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,IF,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00051399-M03 |
Product name: | TRAPPC4 monoclonal antibody (M03), clone 2D5 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant TRAPPC4. |
Clone: | 2D5 |
Isotype: | IgG1 Kappa |
Gene id: | 51399 |
Gene name: | TRAPPC4 |
Gene alias: | CGI-104|HSPC172|PTD009|SBDN|SYNBINDIN|TRS23 |
Gene description: | trafficking protein particle complex 4 |
Genbank accession: | BC010866 |
Immunogen: | TRAPPC4 (AAH10866, 1 a.a. ~ 219 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAIFSVYVVNKAGGLIYQLDSYAPRAEAEKTFSYPLDLLLKLHDERVLVAFGQRDGIRVGHAVLAINGMDVNGRYTADGKEVLEYLGNPANYPVSIRFGRPRLTSNEKLMLASMFHSLFAIGSQLSPEQGSSGIEMLETDTFKLHCYQTLTGIKFVVLADPRQAGIDSLLRKIYEIYSDFALKNPFYSLEMPIRCELFDQNLKLALEVAEKAGTFGPGS |
Protein accession: | AAH10866 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (49.83 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | TRAPPC4 monoclonal antibody (M03), clone 2D5. Western Blot analysis of TRAPPC4 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,IF,ELISA,WB-Re |
Shipping condition: | Dry Ice |