AMMECR1 purified MaxPab mouse polyclonal antibody (B01P) View larger

AMMECR1 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AMMECR1 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about AMMECR1 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00009949-B01P
Product name: AMMECR1 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human AMMECR1 protein.
Gene id: 9949
Gene name: AMMECR1
Gene alias: AMMERC1
Gene description: Alport syndrome, mental retardation, midface hypoplasia and elliptocytosis chromosomal region gene 1
Genbank accession: NM_001025580.1
Immunogen: AMMECR1 (NP_001020751.1, 1 a.a. ~ 296 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAAGCCGVKKQKLSSSPPSGSGGGGGASSSSHCSGESQCRAGELGLGGAGTRLNGLGGLTGGGSGSGCTLSPPQGCGGGGGGIALSPPPSCGVGTLLSTPAAATSSSPSSSSAASSSSPGSRKMVVSAEMCCFCFDVLYCHLYGYQQPRTPRFTNEPYALKDSRFPPMTRDELPRLFCSVSLLTNFEDVCDYLDWEVGVHGIRIEFINEKGSKRTATYLPEVAKEQGWDHIQTIDSLLRKGGYKAPITNEFRKTIKLTRYRSEKMTLSYAEYLAHRQHHHFQNGIGHPLPPYNHYS
Protein accession: NP_001020751.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009949-B01P-13-15-1.jpg
Application image note: Western Blot analysis of AMMECR1 expression in transfected 293T cell line (H00009949-T01) by AMMECR1 MaxPab polyclonal antibody.

Lane1:AMMECR1 transfected lysate(32.56 KDa).
Lane2:Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy AMMECR1 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart